6225 Old Salem Rd NE | Albany, OR 97321
(541) 992-4720
pnwautowork@gmail.com

Our Services

Handling all of your automotive needs

Routine Services

30/60/90k+ Vehicle Servicing. Preventative Maintenance

Tune Ups

Performance enhancements

RV Repair

More Recreation Less Worrying
Learn More

Oil Changes

Let us handle the hassle.

Motor-home Maintenance

30/60/90k+ Vehicle Servicing. Preventative Maintenance
Learn More

Fifth-Wheel Repair

Fifth Wheel maintenance repair when you need it.

Fluid and Filter Changes

Make your vehicle happy.

Safety Inspections

Pre Delivery inspections and essential vehicle item reviews.

Brake Repair

Brakes are never something to leave to chance.

Suspension Repair

Ride easy

Steering Component Repair

Take and Keep Control

Diagnosis

 Check Engine Light on? Hearing a weird noise? Something seem off? We will find out what is wrong.

Electrical Diagnosis and Repair

We handle more than just mechanical issues.

Transmission Services

Automatic or Manual, make sure you're transferring that power as intended.

Exhaust Repair

Keeping things sounding right and catalytic converts doing their jobs.

Full Custom Engine Swaps

Want to change things up? We can help.

Turbo Builds

Get the most out of that engine.

Mobile Welding and Light Fabrication

From custom roll-cages to beautiful BBQs

GET STARTED

We'd love to work with you.

START A PROJECT
Automotive Repair Done Right
magic-wanddropdatabasecogstarleafbuscarclocklinkthumbs-upmagnifierwarningcheckmark-circleplus-circlelayers linkedin facebook pinterest youtube rss twitter instagram facebook-blank rss-blank linkedin-blank pinterest youtube twitter instagram